PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009626870.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 439aa    MW: 49494.4 Da    PI: 6.3573
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009626870.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.21.7e-17108154148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+WT eEd +l+++vkqlG + W+ Ia++m   R +kqc++rw+++l
   XP_009626870.1 108 KGPWTDEEDSKLLRLVKQLGVRKWAQIAEKMD-ARAGKQCRERWHNHL 154
                      79******************************.*************97 PP

2Myb_DNA-binding60.24.4e-19160202145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      ++ W++eE++ lv+a+kqlG++ W+ Ia++++ gRt++++k++w+
   XP_009626870.1 160 KDTWSEEEELMLVEAHKQLGNK-WAEIAKRIP-GRTENSIKNHWN 202
                      679*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129427.276103158IPR017930Myb domain
SMARTSM007172.9E-15107156IPR001005SANT/Myb domain
SuperFamilySSF466899.35E-30107201IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.7E-26109161IPR009057Homeodomain-like
CDDcd001676.93E-14110154No hitNo description
PfamPF139217.7E-19111170No hitNo description
SMARTSM007171.6E-17159207IPR001005SANT/Myb domain
PROSITE profilePS5129419.676159209IPR017930Myb domain
CDDcd001672.94E-13162205No hitNo description
Gene3DG3DSA:1.10.10.602.8E-21162207IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 439 aa     Download sequence    Send to blast
MEGGSSAFRP YQNLPKNYLG STPPFTAIDR FLWSHENYFY PLSSSSSSSQ ANGVSWPKTL  60
PEPSFIEGFF LNEQESDLIE EANSVQKNKR ESWKKAKEGN STTNYLVKGP WTDEEDSKLL  120
RLVKQLGVRK WAQIAEKMDA RAGKQCRERW HNHLRPDIKK DTWSEEEELM LVEAHKQLGN  180
KWAEIAKRIP GRTENSIKNH WNATKRRMNS RRNKKRKNQQ DGQNERQNRS NVLQDYIRSV  240
CFADDSPLTT ATYHSGGGSG GGGGCSSTTT TVTQSNSTIT NATLTYSDDD SPSLLTHQTC  300
DEEMNFMQNL FGKNSLLSDN NGTKAIDHSM EAKVTQNLFD NNSSISNSAF NSFGENPLSN  360
GQETQLQYSQ HFCPDVYLPY LLDGSSYNPE CFGYGNSMNM QMNQASGCSS EGNNKVEVDL  420
MEFVSSSHFS QGTFNNTFF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-431062075106B-MYB
1mse_C2e-431062072103C-Myb DNA-Binding Domain
1msf_C2e-431062072103C-Myb DNA-Binding Domain
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1204215KRRMNSRRNKKR
2210216RRNKKRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009626870.10.0PREDICTED: myb-like protein Q
RefseqXP_016435339.10.0PREDICTED: transcriptional activator Myb-like
TrEMBLK4CA421e-149K4CA42_SOLLC; Uncharacterized protein
STRINGSolyc06g076840.1.11e-149(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA48251941
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58850.18e-62myb domain protein 119